Product Overview
Description:
Recombinant Mouse Leptin Protein is expressed in E. coli with an N-6×His tag. It is produced in a cost-effective E. coli expression system, and the His-tag enables straightforward purification and detection. Recombinant Mouse leptin protein-tag is an engineered mouse cytokine featuring a His-tag for streamlined detection and affinity purification. It offers excellent solubility and purity, making it a robust tool for structural biology, mouse receptor-binding validation, and metabolic biomarker screening. It is suitable for a range of in vitro and cell-based research applications, including protein characterization, binding, and functional studies.
Source:
Escherichia coli
Expression Region:
Val22-Cys167
Sequence:
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Molecular Weight:
Approximately 16-18 kDa
Bioactivity:
The ED50 for this effect is ≤2.5 ng/mL as determined by a dose-dependent cell proliferation assay using MCF-7 cells, corresponding to a specific activity of ≥4.0 × 10^5 U/mg.
Tag:
N-terminal 6×His
Purity:
≥95% by SDS-PAGE
Endotoxin Test:
<1.0 EU/μg as determined by the LAL method
Applications:
ELISA; WB; Functional Assay; Cell Culture; Binding Assay; SPR; BLI; FACS; Positive Control
Specification
Formulation:
Lyophilized from a 0.22 μm sterile-filtered Tris-HCl solution containing NaCl and arginine.
Storage:
Storage at -20°C.
Shipping Condition:
Shipped with blue ice.
Handling Notes:
During shipping, trace amounts of the recombinant protein may adhere to the interior surface of the vial cap. Before opening, it is highly recommended to briefly centrifuge the vial to bring all contents to the bottom. Avoid repeated freeze-thaw cycles to prevent activity loss.
Target Profile
Full Name:
Leptin
Alternative Names:
Obesity factor; Obesity protein; OB; Lep
Accession Number:
NP_032519.1
Summary:
Leptin (LEP) is an adipocyte-derived hormone secreted by white adipocytes into the systemic circulation, where it governs energy homeostasis. By binding its receptor in the brain, leptin activates downstream signaling that suppresses feeding and increases energy expenditure, while additionally exerting endocrine actions on immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation, and wound healing. Mutations within LEP or its regulatory regions cause severe and morbid obesity with hypogonadism in patients and contribute to the development and progression of type 2 diabetes mellitus.
