Recombinant Carassius auratus Leptin Protein, N-His-tag (P. pastoris)

Cat. No.: OB0626-WX10

Species: Carassius auratus

Origin: Recombinant

Conjugation: Unconjugate

Size:

INQUIRY Datasheet MSDS

Add to basket

Product Overview

Description: Recombinant Carassius auratus Leptin Protein is expressed in P. pastoris with an N-8×His tag. The eukaryotic P. pastoris host supports proper folding and disulfide-bond formation, and the His-tag enables straightforward purification and detection. Recombinant Carassius auratus leptin protein-tag is a specialized teleost cytokine engineered with a His-tag for enhanced stability during comparative endocrinology studies. It serves as an invaluable and highly specific tool for aquaculture research and studying fish energy homeostasis pathways. It is suitable for a range of in vitro and cell-based research applications, including protein characterization, binding, and functional studies.

Source: Pichia pastoris

Expression Region: Pro22-Cys171

Sequence: PVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC

Molecular Weight: Approximately 17.0 kDa

Tag: N-terminal 8×His

Purity: ≥96% by SDS-PAGE

Endotoxin Test: <1.0 EU/μg as determined by the LAL method

Applications: ELISA; WB; Functional Assay; Cell Culture; Binding Assay; SPR; BLI; FACS; Positive Control

Specification

Formulation: Lyophilized from a 0.22 μm sterile-filtered citrate solution containing trehalose, mannitol, and Tween-80.

Storage: Storage at -20°C.

Shipping Condition: Shipped with blue ice.

Handling Notes: During shipping, trace amounts of the recombinant protein may adhere to the interior surface of the vial cap. Before opening, it is highly recommended to briefly centrifuge the vial to bring all contents to the bottom. Avoid repeated freeze-thaw cycles to prevent activity loss.

Target Profile

Full Name: Leptin

Alternative Names: rCaLeptin; Obesity factor; Obesity protein; OB; Lep

Uniprot ID: B8YI02

Accession Number: ACL68083.1

Summary: Leptin (LEP) is an adipocyte-derived hormone secreted by white adipocytes into the systemic circulation, where it governs energy homeostasis. By binding its receptor in the brain, leptin activates downstream signaling that suppresses feeding and increases energy expenditure, while additionally exerting endocrine actions on immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation, and wound healing. Mutations within LEP or its regulatory regions cause severe and morbid obesity with hypogonadism in patients and contribute to the development and progression of type 2 diabetes mellitus.

Related Products

Inquiry

Inquiry Basket

Check Out