Recombinant Human Leptin Protein, Tag-free (E. coli)

Cat. No.: OB0626-WX1

Species: Human

Origin: Recombinant

Conjugation: Unconjugate

Size:

INQUIRY Datasheet MSDS

Add to basket

Product Overview

Description: Recombinant Human Leptin Protein is expressed in E. coli as a tag-free protein. Produced in a cost-effective E. coli expression system, without fusion tags, preserving native folding for ligand–receptor interaction and binding studies. Recombinant human leptin protein is a tag-free bioactive cytokine essential for regulating energy homeostasis and body weight. This high-purity, native-form protein is optimized for cell-based metabolic assays, leptin receptor binding studies, and in vitro obesity research.

Source: Escherichia coli

Expression Region: Val22-Cys167

Sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Molecular Weight: Approximately 13-16 kDa

Bioactivity: Measured by its ability to induce proliferation in human Leptin R-transfected BaF3 cells, the ED₅₀ for this effect is ≤5.0 ng/mL. This corresponds to a specific activity of ≥2.0 x 10^5 U/mg.

Tag: Free

Purity: ≥95% by SDS-PAGE

Endotoxin Test: <1.0 EU/μg as determined by the LAL method

Applications: ELISA; WB; Functional Assay; Cell Culture; Binding Assay; SPR; BLI; FACS; Positive Control

Specification

Formulation: Lyophilized from a 0.22 μm sterile-filtered solution in PBS with trehalose.

Storage: Storage at -20°C.

Shipping Condition: Shipped with blue ice.

Handling Notes: During shipping, trace amounts of the recombinant protein may adhere to the interior surface of the vial cap. Before opening, it is highly recommended to briefly centrifuge the vial to bring all contents to the bottom. Avoid repeated freeze-thaw cycles to prevent activity loss.

Target Profile

Full Name: Leptin

Alternative Names: rHuLeptin; Obesity factor; Obesity protein; OB; Lep

Gene ID: 3952

Uniprot ID: P41159

Accession Number: NP_000221.1

Summary: Leptin (LEP) is an adipocyte-derived hormone secreted by white adipocytes into the systemic circulation, where it governs energy homeostasis. By binding its receptor in the brain, leptin activates downstream signaling that suppresses feeding and increases energy expenditure, while additionally exerting endocrine actions on immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation, and wound healing. Mutations within LEP or its regulatory regions cause severe and morbid obesity with hypogonadism in patients and contribute to the development and progression of type 2 diabetes mellitus.

Related Products

Inquiry

Inquiry Basket

Check Out